>gi|15842976|ref|NP_338013.1| hypothetical protein MT3491.1 [Mycobacterium tuberculosis CDC1551] MGGECYAMVVRFPREHNAKLKQLHAETEPKGRPAGKAATGEL
Molecule Role
Virulence factor
Molecule Role Annotation
MUTATION: MT3491.1 mutant is attenuated in survival within macrophages (Pethe et al., 2004).
References
Pethe et al., 2004: Pethe K, Swenson DL, Alonso S, Anderson J, Wang C, Russell DG. Isolation of Mycobacterium tuberculosis mutants defective in the arrest of phagosome maturation. Proceedings of the National Academy of Sciences of the United States of America. 2004; 101(37); 13642-13647. [PubMed: 15340136].