>gi|119223229|ref|YP_910497.1| hypothetical protein VACWR053.5 [Vaccinia virus]
MVIGLVIFVSVAAAIVGVLSNVLDMLMYVEENNEEDARIKEEQELLLLY
Molecule Role
Virulence factor
Molecule Role Annotation
We have shown that insertion of the three vaccinia virus (VACV) promoter-driven foreign gene expression cassettes encoding Renilla luciferase-Aequorea GFP fusion protein, β-galactosidase, and β-glucuronidase into the F14.5L, J2R, and A56R loci of the VACV LIVP genome, respectively, results in a highly attenuated mutant strain GLV-1h68. This strain shows tumor-specific replication and is capable of eradicating tumors with little or no virulence in mice. (Chen et al., 2011)
References
Chen et al., 2011: Chen NG, Yu YA, Zhang Q, Szalay AA. Replication efficiency of oncolytic vaccinia virus in cell cultures prognosticates the virulence and antitumor efficacy in mice. Journal of translational medicine. 2011; 9; 164. [PubMed: 21951588].