>gi|13559812|ref|NP_112024.1| C protein [Nipah virus]
MMASILLTLFRRTKKKYRRHTDDQVFNNPASKIKQKPGKIFCSAPVENLNKLRGECLRMMEMLKEETWRI
YPVLLPQMELLERECRTPVTGQKVQMTYNWTQWLQTLYTMIMEENVPDMDLLQALREGGVITHQEQTMGM
YVLYLMQRCCPMLPKLQFLKKIGKLI
Molecule Role
Virulence factor
Molecule Role Annotation
We have analyzed the role of the nonstructural NiV C protein in viral immunopathogenesis using recombinant virus lacking the expression of NiV C (NiVÃâC). While wild-type NiV was highly pathogenic in the hamster animal model, NiVÃâC was strongly attenuated. (Guillaume et al., 2004)
References
Guillaume et al., 2004: Guillaume V, Contamin H, Loth P, Georges-Courbot MC, Lefeuvre A, Marianneau P, Chua KB, Lam SK, Buckland R, Deubel V, Wild TF. Nipah virus: vaccination and passive protection studies in a hamster model. Journal of virology. 2004; 78(2); 834-840. [PubMed: 14694115].
