hydrophobic IMV membrane protein; nonessential structural protein; similar to Vaccinia virus strain Copenhagen A14.5L; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins;
>gi|66275931|ref|YP_233016.1| nonessential hydrophobic IV and IMV membrane protein [Vaccinia virus]
MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI
Molecule Role
Virulence factor
Molecule Role Annotation
A mutant virus, in which the A14.5L ORF was largely deleted, produced normal-size plaques in several cell lines, and the yields of infectious intra- and extracellular viruses were similar to those of the parent. In contrast, with a mouse model, mutant viruses with the A14.5L ORF largely deleted were attenuated relative to that of the parental virus or a mutant virus with a restored A14.5L gene. (Betakova et al., 2000)
References
Betakova et al., 2000: Betakova T, Wolffe EJ, Moss B. The vaccinia virus A14.5L gene encodes a hydrophobic 53-amino-acid virion membrane protein that enhances virulence in mice and is conserved among vertebrate poxviruses. Journal of virology. 2000; 74(9); 4085-4092. [PubMed: 10756020].
