>gi|206570298|gb|ACI12930.1| capsid protein [Tick-borne encephalitis virus]
MARKAILKGKGGGPPRRVSKETAKKTRQSRVQMPN
Molecule Role
Virulence factor
Molecule Role Annotation
MUTATION: A virus with a mutation in protein C is attenuated in mice (Kofler et al., 2002).
References
Kofler et al., 2002: Kofler RM, Heinz FX, Mandl CW. Capsid protein C of tick-borne encephalitis virus tolerates large internal deletions and is a favorable target for attenuation of virulence. Journal of virology. 2002; 76(7); 3534-3543. [PubMed: 11884577].