>gi|158516889|ref|YP_001527878.1| capsid protein [West Nile virus]
MSKKPGGPGKSRAVNMLKRGMPRVLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIAPTRAVLDRWR
GVNKQTAMKHLLSFKKELGTLTSAINRRSSKQKKR
Molecule Role
Virulence factor
Molecule Role Annotation
MUTATION: A virus with a C protein mutation is attenuated in mice (Schlick et al., 2010).
References
Schlick et al., 2010: Schlick P, Kofler RM, Schittl B, Taucher C, Nagy E, Meinke A, Mandl CW. Characterization of West Nile virus live vaccine candidates attenuated by capsid deletion mutations. Vaccine. 2010; 28(36); 5903-5909. [PubMed: 20600500].