>gi|9558716|gb|AAB30044.2| envelope protein [Yellow fever virus]
TLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCRIPVIVADDLTAAINKGILVTVNPIASTND
DEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGKLFTQTMKG
Molecule Role
Virulence factor
Molecule Role Annotation
MUTATION: E protein mutations in the 17D strain led to mortality and morbidity in mice defective in both type I and type II interferon responses (McArthur et al., 2005). .
References
McArthur et al., 2005: McArthur MA, Xiao SY, Barrett AD. Phenotypic and molecular characterization of a non-lethal, hamster-viscerotropic strain of yellow fever virus. Virus research. 2005; 110(1-2); 65-71. [PubMed: 15845256].
