>gi|209559117|ref|YP_002285589.1| streptolysin S associated protein SagA [Streptococcus pyogenes NZ131] MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGGSGSYTPGK
Eberhard et al., 2001: Eberhard TH, Sledjeski DD, Boyle MD. Mouse skin passage of a Streptococcus pyogenes Tn917 mutant of sagA/pel restores virulence, beta-hemolysis and sagA/pel expression without altering the position or sequence of the transposon. BMC microbiology. 2001; 1; 33. [PubMed: 11801184].