|
|
virB5 from Brucella melitensis biovar Abortus 2308 |
| Victor ID |
1758 |
|
Gene Name |
virB5 from Brucella melitensis biovar Abortus 2308 |
|
Sequence Strain (Species/Organism) |
Brucella melitensis biovar Abortus 2308 |
|
NCBI Gene ID |
3827978
|
|
NCBI Protein GI |
83269018
|
|
Locus Tag |
BAB2_0064 |
|
Protein Accession |
YP_418309.1 |
|
Other Database IDs |
UniProtKB-ID: VIRB5_BRUA2 UniRef100: UniRef100_Q2YJ75 UniRef90: UniRef90_Q2YJ75 UniRef50: UniRef50_Q2YJ75 UniParc: UPI00000B5188 EMBL: AF226278 EMBL: AM040265 EMBL-CDS: AAF73898.1 EMBL-CDS: CAJ12230.1 RefSeq_NT: NC_007624.1 GenomeReviews: AM040265_GR KEGG: bmf:BAB2_0064 eggNOG: NOG08232 HOGENOM: HBG531833 OMA: IQNEQTK ProtClustDB: CLSK884267 BioCyc: BMEL359391:BAB2_0064-MONOMER |
|
Taxonomy ID |
359391
|
|
Chromosome No |
II |
|
Gene Starting Position |
62030 |
|
Gene Ending Position |
62746 |
|
Gene Strand (Orientation) |
- |
|
Protein Name |
attachment mediating protein virB5 homolog KO: K03200 type IV secretion system protein VirB5 |
|
DNA Sequence |
>gi|83268957:62030-62746 Brucella melitensis biovar Abortus 2308 chromosome II, complete genome
GTTAATAGGCGGCTTCCAGTGCTTTCGGCTGCGGATAGCCGCGCCGGGCATTATCCTTCGCGTCTAATTC
GTGCTGGCGTTCGTCCAGGAGCTTGTCCTGTGCCTCTGCCATCTGCTGGTAGAGACGAAGGCGGGTGTCT
TCGTTTTGGATCATGGCATTTTCGCTTTCGATCCGGCCTTGCAATTCGGCAATCGCCTTCGGGTCTCCCG
TCTTGTTGATCTCCTGCATCAAGCTCTCGATCTCTTGTAGGCGTTTGTCAGTGGCGTCGTAGGCTTTGGA
CGTCATGACCTTGTCCTGGACCGGCTTCACCACTTTAGCCTCACATGCGATGCGCTGATCTTTGTCGGAG
ATGGAGGCACACGGATCGTATACCTGGCTTTTGCGTAAGAGGTTGGCCGTTTCGCCAGCCGCCGCCAGGT
AGCCGCCGCTCATCACCGCTTCGTAGAGATCTCGCCAGTTATGTGGCAGATAGCTACGCAGCGTAGGGTC
GCGGAGAATATCGCCAAGGCCACGGTTGCCGGTCAGGGCATCGAACTGCATTTTCTGTTGTTCAAACTGC
TGTTTCAGTTGCTCGATCTGCTGGGCGAACTTCACCATCTGTTCGAGATGGTTGGCCAGGTTCTGCGCGA
TGGAGCCGGCATCTGTCACCGGGAGCTGTGCGTGCGCCGTGCTGGTTACAGTCAGGGCGAATGCGAAGCT
GAGAATTATCTTCTTCA
|
|
Protein Sequence |
>gi|83269018|ref|YP_418309.1| type IV secretion system protein VirB5 [Brucella abortus 2308] MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLRLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
MUTATION: A comparison of the VirB8 and VirB5 contents after induction of the B suis wild type and of virB5 and virB12 mutants further confirmed that the virB5 and virB12 genes belong to the same operon (Rouot et al., 2003).
Smooth strains of Brucella unable to replicate (ie, killed B suis or the avirulent mutant B suis virB5) exhibit delayed phagosome-lysosome fusion (Porte et al., 2003).
Polar mutations in the operon upstream of virB5 exert a greater effect on the expression of virB5 than they do on the expression of the downstream gene virB12. It indicates that in B abortus , regulatory elements other than the virB promoter may influence VirB12 protein levels (Sun et al., 2005).
Four independent mutants in virB5, virB9 or virB10 were highly attenuated in an in vitro infection model with human macrophages (O'Callaghan et al., 1999). |
| References |
O'Callaghan et al., 1999: O'Callaghan D, Cazevieille C, Allardet-Servent A, Boschiroli ML, Bourg G, Foulongne V, Frutos P, Kulakov Y, Ramuz M. A homologue of the Agrobacterium tumefaciens VirB and Bordetella pertussis Ptl type IV secretion systems is essential for intracellular survival of Brucella suis. Molecular microbiology. 1999; 33(6); 1210-1220. [PubMed: 10510235].
Porte et al., 2003: Porte F, Naroeni A, Ouahrani-Bettache S, Liautard JP. Role of the Brucella suis lipopolysaccharide O antigen in phagosomal genesis and in inhibition of phagosome-lysosome fusion in murine macrophages. Infection and immunity. 2003; 71(3); 1481-1490. [PubMed: 12595466].
Rouot et al., 2003: Rouot B, Alvarez-Martinez MT, Marius C, Menanteau P, Guilloteau L, Boigegrain RA, Zumbihl R, O'Callaghan D, Domke N, Baron C. Production of the type IV secretion system differs among Brucella species as revealed with VirB5- and VirB8-specific antisera. Infection and immunity. 2003; 71(3); 1075-1082. [PubMed: 12595417].
Sun et al., 2005: Sun YH, Rolán HG, den Hartigh AB, Sondervan D, Tsolis RM. Brucella abortus virB12 is expressed during infection but is not an essential component of the type IV secretion system. Infection and immunity. 2005; 73(9); 6048-6054. [PubMed: 16113325].
|
|