|
|
virb10 |
| Victor ID |
1336 |
|
Gene Name |
virb10 |
|
Sequence Strain (Species/Organism) |
Brucella melitensis bv. 1 str. 16M |
|
NCBI Gene ID |
1197805
|
|
NCBI Protein GI |
17988378
|
|
Locus Tag |
BMEII0034 |
|
Genbank Accession |
AE008918 |
|
Protein Accession |
NP_541011 |
|
Other Database IDs |
UniProtKB-ID: VIRBA_BRUME
UniRef100: UniRef100_Q8YDZ0
UniRef90: UniRef90_Q2YJ81
UniRef50: UniRef50_Q2YJ81
UniParc: UPI0001529A7C
EMBL: AE008918
EMBL-CDS: AAL53275.1
RefSeq_NT: NC_003318.1
GenomeReviews: AE008918_GR
KEGG: bme:BMEII0034
HOGENOM: HBG365517
OMA: TMERLAN
ProtClustDB: CLSK898650
BioCyc: BMEL224914:BMEII0034-MONOMER
|
|
Taxonomy ID |
224914
|
|
Chromosome No |
II |
|
Gene Starting Position |
33405 |
|
Gene Ending Position |
34202 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
channel protein VIRB10-like protein |
|
Protein pI |
7.41 |
|
Protein Weight |
26516.78 |
|
Protein Length |
265 |
|
DNA Sequence |
>gi|17988344:33405-34202 Brucella melitensis bv. 1 str. 16M chromosome chromosome II, complete sequence
ATTGCCGGATGATACGCCGGCAAAGGACGATGTACTGGACAAGTCGGCCAGCGCGTTGATGGTCGTCACC
AAGTCCAGCGGCGATACGGTCGTTCAAACGACCAATGCGCGCATTCAAGCCCTGCTCGACAGTCAAAAGA
ACACCAAGCAGGATGCTGGATCGCTGGGTACTCTCCTTCACGGCACACAAACGGATGCACGCATGGCGAG
CCTTCTGCGCAACCGTGATTTCCTGCTCGCGAAGGGCAGCATCATCAATTGCGCGCTGCAAACCCGTCTG
GATTCGACGGTGCCGGGCATGGCTGCCTGCGTGGTCACACGCAACATGTATAGCGATAACGGCAAGGTGT
TGCTGATTGAGCGCGGTTCAACCATCTCGGGTGAATATGATGCCAACGTAAAGCAGGGCATGGCTCGCAT
TTATGTCCTGTGGACGCGCGTGAAGACGCCGAACGGTGTCGTGATCGATCTCGACTCTCCAGGCGCCGAC
CCCCTGGGCGGGGCAGGCTTGCCCGGCTACATCGACTCCCACTTCTGGAAGCGCTTTGGCGGCGCCTTGA
TGTTGAGCACGATCGAGACCCTCGGCCGCTATGCAACCCAGAAGGTCGGCGGCGGGGGTTCAAATCAGAT
CAACCTCAATACCGGCGGAGGTGAATCGACGAGCAACCTGGCTTCAACTGCCTTGAAGGATACGATCAAC
ATTCCGCCGACACTGTACAAGAACCAGGGCGAAGAGATCGGCATCTATATCGCCCGCGACCTAGATTTTT
CGAGTGTGTATGATGTCAAACCGAAGTG
|
|
Protein Sequence |
>gi|17988378|ref|NP_541011.1| channel protein VIRB10-like protein [Brucella melitensis bv. 1 str. 16M]
MPDDTPAKDDVLDKSASALMVVTKSSGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMAS
LLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARI
YVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQI
NLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
MUTATION: Mutants with polar and nonpolar mutations introduced in irB10 showed different behaviors in mice and in the HeLa cell infection assay, suggesting that virB10 per se is necessary for the correct function of this type IV secretion apparatus (Sieira et al., 2000).
A B. abortus virB10 mutant showed a decrease of intracellular live bacteria comparable to that of the wild-type strain until 4 h after infection, indicating that a functional VirB system is not required for the short-term survival of Brucella inside macrophages. At later time points, the number of live virB10 mutants progressively decreased. Hence, the Brucella virB10 strain did not replicate, but rather was killed. Although the virB10 mutants are capable of short-term survival, they can not evade long-term degradation through fusion with lysosomes (Celli et al., 2003).
B abortus virB1 and virB10 mutants are unable to persist in mouse spleens after i.p. inoculation, suggest that attenuation in the animal model is due to an inability of these strains to grow intracellularly (Hong et al., 2000).
A B abortus virB10 mutant lost the ability to multiply in HeLa cells and was not recovered from the spleens of infected BALBc mice (Briones et al., 2001).
The non polar virB10 mutant was able to block the acquisition of cathepsin D, but was not able to translocate to the replication compartment (Boschiroli et al., 2002).
The virB10 non-polar mutants were capable of avoiding interactions with the endocytic pathway but , diverging to wild-type Brucella, were unable to reach the endoplasmic reticulum to establish their intracellular replication niche and seemed to be recycled to the cell surface (Comerci et al., 2001). |
|
COG
|
COG2948U, under U: Intracellular trafficking, secretion, and vesicular transport |
| References |
Boschiroli et al., 2002: Boschiroli ML, Ouahrani-Bettache S, Foulongne V, Michaux-Charachon S, Bourg G, Allardet-Servent A, Cazevieille C, Lavigne JP, Liautard JP, Ramuz M, O'Callaghan D. Type IV secretion and Brucella virulence. Veterinary microbiology. 2002; 90(1-4); 341-348. [PubMed: 12414154].
Briones et al., 2001: Briones G, Iñón de Iannino N, Roset M, Vigliocco A, Paulo PS, Ugalde RA. Brucella abortus cyclic beta-1,2-glucan mutants have reduced virulence in mice and are defective in intracellular replication in HeLa cells. Infection and immunity. 2001; 69(7); 4528-4535. [PubMed: 11401996].
Celli et al., 2003: Celli J, de Chastellier C, Franchini DM, Pizarro-Cerda J, Moreno E, Gorvel JP. Brucella evades macrophage killing via VirB-dependent sustained interactions with the endoplasmic reticulum. The Journal of experimental medicine. 2003; 198(4); 545-556. [PubMed: 12925673].
Comerci et al., 2001: Comerci DJ, MartÃnez-Lorenzo MJ, Sieira R, Gorvel JP, Ugalde RA. Essential role of the VirB machinery in the maturation of the Brucella abortus-containing vacuole. Cellular microbiology. 2001; 3(3); 159-168. [PubMed: 11260139].
Hong et al., 2000: Hong PC, Tsolis RM, Ficht TA. Identification of genes required for chronic persistence of Brucella abortus in mice. Infection and immunity. 2000; 68(7); 4102-4107. [PubMed: 10858227].
Sieira et al., 2000: Sieira R, Comerci DJ, Sánchez DO, Ugalde RA. A homologue of an operon required for DNA transfer in Agrobacterium is required in Brucella abortus for virulence and intracellular multiplication. Journal of bacteriology. 2000; 182(17); 4849-4855. [PubMed: 10940027].
|
|
