|
|
virB5 from Brucella melitensis bv. 1 str. 16M |
| Victor ID |
1332 |
|
Gene Name |
virB5 from Brucella melitensis bv. 1 str. 16M |
|
Sequence Strain (Species/Organism) |
Brucella melitensis bv. 1 str. 16M |
|
NCBI Gene ID |
1197800
|
|
NCBI Protein GI |
17988373
|
|
Locus Tag |
BMEII0029 |
|
Protein Accession |
NP_541006.1 |
|
Other Database IDs |
UniProtKB-ID: D0B5R7_BRUME UniRef100: UniRef100_Q57A18 UniRef90: UniRef90_Q2YJ75 UniRef50: UniRef50_Q2YJ75 UniParc: UPI000005830C EMBL: GG703779 EMBL-CDS: EEW86959.1 RefSeq_NT: NC_003318.1 OMA: IQNEQTK |
|
Taxonomy ID |
224914
|
|
Chromosome No |
II |
|
Gene Starting Position |
29194 |
|
Gene Ending Position |
29910 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
VirB5 |
|
DNA Sequence |
>gi|17988344:29194-29910 Brucella melitensis bv. 1 str. 16M chromosome chromosome II, complete sequence
TATGAAGAAGATAATTCTCAGCTTCGCATTCGCCCTGACTGTAACCAGCACGGCGCACGCACAGCTCCCG
GTGACAGATGCCGGCTCCATCGCGCAGAACCTGGCCAACCATCTCGAACAGATGGTGAAGTTCGCCCAGC
AGATCGAGCAACTGAAACAGCAGTTTGAACAACAGAAAATGCAGTTCGATGCCCTGACCGGCAACCGTGG
CCTTGGCGATATTCTCCGCGACCCTACGCTGCGTAGCTATCTGCCACATAACTGGCGAGATCTCTACGAA
GCGGTGATGAGCGGCGGCTACCTGGCGGCGGCTGGCGAAACGGCCAACCTCTTACGCAAAAGCCAGGTAT
ACGATCCGTGTGCCTCCATCTCCGACAAAGATCAGCGCATCGCATGTGAGGCTAAAGTGGTGAAGCCGGT
CCAGGACAAGGTCATGACGTCCAAAGCCTACGACGCCACTGACAAACGCCTACAAGAGATCGAGAGCTTG
ATGCAGGAGATCAACAAGACGGGAGACCCGAAGGCGATTGCCGAATTGCAAGGCCGGATCGAAAGCGAAA
ATGCCATGATCCAAAACGAAGACACCCGCCTTCATCTCTACCAGCAGATGGCAGAGGCACAGGACAAGCT
CCTGGACGAACGCCAGCACGAATTAGACGCGAAGGATAATGCCCGGCGCGGCTATCCGCAGCCGAAAGCA
CTGGAAGCCGCCTATTA
|
|
Protein Sequence |
>gi|17988373|ref|NP_541006.1| VirB5 [Brucella melitensis bv. 1 str. 16M] MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
MUTATION: A comparison of the VirB8 and VirB5 contents after induction of the B suis wild type and of virB5 and virB12 mutants further confirmed that the virB5 and virB12 genes belong to the same operon (Rouot et al., 2003).
Smooth strains of Brucella unable to replicate (ie, killed B suis or the avirulent mutant B suis virB5) exhibit delayed phagosome-lysosome fusion (Porte et al., 2003).
Polar mutations in the operon upstream of virB5 exert a greater effect on the expression of virB5 than they do on the expression of the downstream gene virB12. It indicates that in B abortus , regulatory elements other than the virB promoter may influence VirB12 protein levels (Sun et al., 2005).
Four independent mutants in virB5, virB9 or virB10 were highly attenuated in an in vitro infection model with human macrophages (O'Callaghan et al., 1999). |
| References |
O'Callaghan et al., 1999: O'Callaghan D, Cazevieille C, Allardet-Servent A, Boschiroli ML, Bourg G, Foulongne V, Frutos P, Kulakov Y, Ramuz M. A homologue of the Agrobacterium tumefaciens VirB and Bordetella pertussis Ptl type IV secretion systems is essential for intracellular survival of Brucella suis. Molecular microbiology. 1999; 33(6); 1210-1220. [PubMed: 10510235].
Porte et al., 2003: Porte F, Naroeni A, Ouahrani-Bettache S, Liautard JP. Role of the Brucella suis lipopolysaccharide O antigen in phagosomal genesis and in inhibition of phagosome-lysosome fusion in murine macrophages. Infection and immunity. 2003; 71(3); 1481-1490. [PubMed: 12595466].
Rouot et al., 2003: Rouot B, Alvarez-Martinez MT, Marius C, Menanteau P, Guilloteau L, Boigegrain RA, Zumbihl R, O'Callaghan D, Domke N, Baron C. Production of the type IV secretion system differs among Brucella species as revealed with VirB5- and VirB8-specific antisera. Infection and immunity. 2003; 71(3); 1075-1082. [PubMed: 12595417].
Sun et al., 2005: Sun YH, Rolán HG, den Hartigh AB, Sondervan D, Tsolis RM. Brucella abortus virB12 is expressed during infection but is not an essential component of the type IV secretion system. Infection and immunity. 2005; 73(9); 6048-6054. [PubMed: 16113325].
|
|