|
|
virb1 |
| Victor ID |
1328 |
|
Gene Name |
virb1 |
|
Sequence Strain (Species/Organism) |
Brucella melitensis bv. 1 str. 16M |
|
NCBI Gene ID |
1197796
|
|
NCBI Protein GI |
17988369
|
|
Locus Tag |
BMEII0025 |
|
Genbank Accession |
AE008918 |
|
Protein Accession |
NP_541002 |
|
Other Database IDs |
UniProtKB-ID: VIRB1_BRUME
UniRef100: UniRef100_Q8YDZ5
UniRef90: UniRef90_Q2YIT5
UniRef50: UniRef50_Q2YIT5
UniParc: UPI0000058308
EMBL: AE008918
EMBL-CDS: AAL53266.1
RefSeq_NT: NC_003318.1
GenomeReviews: AE008918_GR
KEGG: bme:BMEII0025
NMPDR: fig|224914.1.peg.2084
HOGENOM: HBG742087
OMA: VFDPCRN
ProtClustDB: CLSK884272
BioCyc: BMEL224914:BMEII0025-MONOMER
|
|
Taxonomy ID |
224914
|
|
Chromosome No |
II |
|
Gene Starting Position |
24861 |
|
Gene Ending Position |
25577 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
attachment mediating protein VIRB1-like protein |
|
Protein pI |
9.83 |
|
Protein Weight |
22649 |
|
Protein Length |
238 |
|
DNA Sequence |
>gi|17988344:24861-25577 Brucella melitensis bv. 1 str. 16M chromosome chromosome II, complete sequence
TATGGTGCCATTCCTTGTCCTCGCGCAACAATGCGCACCGACTGTTGCACCTCAGACTATGGCAGCAATC
GTGCAGGTCGAGTCGGGCTTCAATCCTTATGCAATAGGCGTCGTTGGTGGGCGGTTGGTCCGTCAACCCG
TTTCCCTTGATGAAGCAATCACGACAGCACAGTCACTGGAAGCCAAAGGCTGGAATTTCTCTTTGGGTAT
TGCTCAAGTCAACAGGTACAATCTGCCGAAATATGGCAGCACCTACGCACAAGCGTTCGACCCCTGCAAG
AACCTGAAGATGGGATCCAAGATCCTTGAAGACTGCTACCGTCGGGCCATCGTGAAGATGCCCGGTCAGG
AACAAGGCGCGCTTCGCGCCGCATTCTCCTGTTACTACGCCGGCAACTTTACGGGCGGCTTCAAGACGAA
GCCCGGCAGTCCCAGCTACGTGCAGAAGGTCGTGGCAAGCGCCGACGTGACCACAAAGCCGATTGTTGTC
GTGCCCATGATCCGGAAAACGCCGGATGCGGCGGCAGCAGTAGCTGCCCCAGTAAAAAAACGACAGCCGG
CTGATCGTAATTCTGTTCTTGTCGATCTGCATCCATCATCGCAGTCGATGCCAGCCACCGGCGCGGCGAA
CGCGCCTGTAAGGCTGAAGACAGAGCAGCCGGCGACAACCGATGCGCCGCCAGGGAAGGATAATACGGAC
GGCGTAGTTGTTTTCTA
|
|
Protein Sequence |
>gi|17988369|ref|NP_541002.1| attachment mediating protein VIRB1-like protein [Brucella melitensis bv. 1 str. 16M]
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLEAKGWNFSLGI
AQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTK
PGSPSYVQKVVASADVTTKPIVVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAAN
APVRLKTEQPATTDAPPGKDNTDGVVVF
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
MUTATION: The Brucella abortus virB operon, encoding a type IV secretion system (T4SS), is required for intracellular replication and persistent infection in the mouse model. The products of the first two genes of the virB operon, virB1 and virB2, are predicted to be localized at the bacterial surface. Both mutants were shown to be nonpolar, as demonstrated by their ability to express the downstream gene virB5 during stationary phase of growth in vitro. Both VirB1 and VirB2 were essential for intracellular replication in J774 macrophages. The nonpolar virB1 mutant persisted at wild-type levels, showing that the function of VirB1 is dispensable in the mouse model of persistent infection (den et al., 2004).
A B abortus polar virB1 mutant failed to replicate in HeLa cells, indicating that the virB operon plays a critical role in intracellular multiplication (Sieira et al., 2000).
Polar mutations in the virB1 to virB2 intergenic region or in virB2 reduced the detection of VirB5 to a greater extent than they did that of VirB12. A virB1 mutation also eliminates the transcription of virB12 in B suis (Sun et al., 2005).
An infection assay with signature-tagged Brucella abortus mutants demonstrated that mutagenesis of the virB1 gene causes attenuation of virulence (Höppner et al., 2005). |
| References |
den et al., 2004: den Hartigh AB, Sun YH, Sondervan D, Heuvelmans N, Reinders MO, Ficht TA, Tsolis RM. Differential requirements for VirB1 and VirB2 during Brucella abortus infection. Infection and immunity. 2004; 72(9); 5143-5149. [PubMed: 15322008].
Höppner et al., 2005: Höppner C, Carle A, Sivanesan D, Hoeppner S, Baron C. The putative lytic transglycosylase VirB1 from Brucella suis interacts with the type IV secretion system core components VirB8, VirB9 and VirB11. Microbiology (Reading, England). 2005; 151(Pt 11); 3469-3482. [PubMed: 16272371].
Sieira et al., 2000: Sieira R, Comerci DJ, Sánchez DO, Ugalde RA. A homologue of an operon required for DNA transfer in Agrobacterium is required in Brucella abortus for virulence and intracellular multiplication. Journal of bacteriology. 2000; 182(17); 4849-4855. [PubMed: 10940027].
Sun et al., 2005: Sun YH, Rolán HG, den Hartigh AB, Sondervan D, Tsolis RM. Brucella abortus virB12 is expressed during infection but is not an essential component of the type IV secretion system. Infection and immunity. 2005; 73(9); 6048-6054. [PubMed: 16113325].
|
|
