|
|
pmtA |
| Victor ID |
1115 |
|
Gene Name |
pmtA |
|
Sequence Strain (Species/Organism) |
Brucella suis 1330 |
|
NCBI Gene ID |
1167830
|
|
NCBI Protein GI |
23502975
|
|
Locus Tag |
BR2127 |
|
Genbank Accession |
AE014291 |
|
Protein Accession |
NP_699102 |
|
Other Database IDs |
UniProtKB-ID: Q8FXX0_BRUSU UniRef100: UniRef100_Q8FXX0 UniRef90: UniRef90_B2S9C3 UniRef50: UniRef50_B2S9C3 UniParc: UPI00000DD7BE EMBL: AE014291 EMBL-CDS: AAN31017.1 RefSeq_NT: NC_004310.3 GenomeReviews: AE014291_GR KEGG: bms:BR2127 NMPDR: fig|204722.1.peg.2059 TIGR: BR2127 HOGENOM: HBG675793 OMA: QFTYAVV ProtClustDB: CLSK864104 BioCyc: BSUI204722:BR_2127-MONOMER |
|
Taxonomy ID |
204722
|
|
Chromosome No |
I |
|
Gene Starting Position |
2052981 |
|
Gene Ending Position |
2053577 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
phospholipid N-methyltransferase |
|
Protein pI |
8.45 |
|
Protein Weight |
19960.5 |
|
Protein Length |
198 |
|
Protein Note |
identified by similarity to GP:9966391 |
|
DNA Sequence |
>gi|56968325:2052981-2053577 Brucella suis 1330 chromosome chromosome I, complete sequence
AATGGCAGGTCAGCTTGGCAGGAAACTCGCCGCGAAGTTCGATGAAGAAATCCGCTTTTTCAAAGGCTGG
ATAGACGGGCCAAAAGCAGTCGGTGCGATTCTGCCCACGAGTTCCATCACGGCGCGGCGCATGGCGAGCG
TCATCGATGTCAATTCGGGCCTGCCCGTGCTTGAGCGGCCGGGCACCGGCGTCATCACCAAGGCTATTCT
CAAGCATGGCGTGAAACCCGCCGATCTTTATTCTATTGAATATTCGCACGATTTTGTGGAGCATCTGAAC
AAGACCTTCCCGGACGTGAACATCATAGAGGGCGATGTGTTCGATCTCGACACGGCATTGGGCGACAGGA
AGGGCCAGAAGTTCGATTGTATCATTTCCGCTGTGCCCATGCTGAATTTCCCCATGGATCGCCGTGTTGA
ACTGGTTGAAAGTCTTCTCACCCACATCCCGCACGGGCGTCCCCTGATGCAGATCACCTATGGACCCTCG
CCGCCGGTTCCGGCAGGGCGCGGCAATTACGTGGTCCAGCATTACGACTTCGTCGTGCGCAATGTGCCGC
CTGCTCAGCTCTGGGTCTATCGCAGTCCGCTTGTATA
|
|
Protein Sequence |
>gi|23502975|ref|NP_699102.1| phospholipid N-methyltransferase [Brucella suis 1330]
MAGQLGRKLAAKFDEEIRFFKGWIDGPKAVGAILPTSSITARRMASVIDVNSGLPVLERPGTGVITKAIL
KHGVKPADLYSIEYSHDFVEHLNKTFPDVNIIEGDVFDLDTALGDRKGQKFDCIISAVPMLNFPMDRRVE
LVESLLTHIPHGRPLMQITYGPSPPVPAGRGNYVVQHYDFVVRNVPPAQLWVYRSPLV
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
MUTATION: The role of Phosphatidylcholine (PC) in Brucella abortus was examined by generating mutants in pcs (BApcs) and pmtA (BApmtA), which encode key enzymes of the two bacterial PC biosynthetic routes, the choline and methyl-transferase pathways. In rich medium, BApcs and the double mutant BApcspmtA but not BApmtA displayed reduced growth, increased phosphatidylethanolamine and no PC, showing that Pcs is essential for PC synthesis under these conditions. In minimal medium, the parental strain, BApcs and BApmtA showed reduced but significant amounts of PC suggesting that PmtA may also be functional Probing with phage Tb, antibiotics, polycations and serum demonstrated that all mutants had altered envelopes. In macrophages, BApcs and BApcspmtA showed reduced ability to evade fusion with lysosomes and establish a replication niche. In mice, BApcs showed attenuation only at early times after infection, BApmtA at later stages and BApcspmtA throughout. The results suggest that Pcs and PmtA have complementary roles in vivo related to nutrient availability and that PC and the membrane properties that depend on this typical eukaryotic phospholipid are essential for Brucella virulence (Conde-Alvarez et al., 2006). |
|
COG
|
COG3963I, under I: Lipid transport and metabolism |
| References |
Conde-Alvarez et al., 2006: Conde-Alvarez R, Grilló MJ, Salcedo SP, de Miguel MJ, Fugier E, Gorvel JP, Moriyón I, Iriarte M. Synthesis of phosphatidylcholine, a typical eukaryotic phospholipid, is necessary for full virulence of the intracellular bacterial parasite Brucella abortus. Cellular microbiology. 2006; 8(8); 1322-1335. [PubMed: 16882035].
|
|