|
|
omp25 from Brucella suis 1330 |
| Victor ID |
1058 |
|
Gene Name |
omp25 from Brucella suis 1330 |
|
Sequence Strain (Species/Organism) |
Brucella suis 1330 |
|
NCBI Gene ID |
1166364
|
|
NCBI Protein GI |
23501588
|
|
Locus Tag |
BR0701 |
|
Protein Accession |
NP_697715.1 |
|
Other Database IDs |
UniProtKB-ID: OM25_BRUSU UniRef100: UniRef100_Q44664 UniRef90: UniRef90_Q44664 UniRef50: UniRef50_Q45335 UniParc: UPI0000130CAF EMBL: U39397 EMBL: AE014291 EMBL-CDS: AAB36695.1 EMBL-CDS: AAN29630.1 RefSeq_NT: NC_004310.3 GenomeReviews: AE014291_GR KEGG: bms:BR0701 TIGR: BR0701 HOGENOM: HBG656555 OMA: CKENAMR ProtClustDB: CLSK898362 BioCyc: BSUI204722:BR_0701-MONOMER |
|
Taxonomy ID |
204722
|
|
Chromosome No |
I |
|
Gene Starting Position |
688318 |
|
Gene Ending Position |
688959 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
outer-membrane protein Omp25 |
|
DNA Sequence |
>gi|56968325:688318-688959 Brucella suis 1330 chromosome I, complete sequence
CATGCGCACTCTTAAGTCTCTCGTAATCGTCTCGGCTGCGCTGCTGCCGTTCTCTGCGACCGCTTTTGCT
GCCGACGCCATCCAGGAACAGCCTCCGGTTCCGGCTCCGGTTGAAGTAGCTCCCCAGTATAGCTGGGCTG
GTGGCTATACCGGTCTTTACCTTGGCTACGGCTGGAACAAGGCCAAGACCAGCACCGTTGGCAGCATCAA
GCCTGACGATTGGAAGGCTGGCGCCTTTGCTGGCTGGAACTTCCAGCAGGACCAGATCGTATACGGTGTT
GAAGGTGATGCAGGTTATTCCTGGGCCAAGAAGTCCAAGGACGGCCTGGAAGTCAAGCAGGGCTTTGAAG
GCTCGCTGCGTGCCCGCGTCGGCTACGACCTGAACCCGGTTATGCCGTACCTCACGGCTGGTATTGCCGG
TTCGCAGATCAAGCTTAACAACGGCTTGGACGACGAAAGCAAGTTCCGCGTGGGTTGGACGGCTGGTGCC
GGTCTCGAAGCCAAGCTGACGGACAACATCCTGGGCCGCGTTGAGTACCGTTACACCCAGTACGGCAACA
AGAACTATGATCTGGCCGGTACGACTGTTCGCAACAAGCTGGACACGCAGGATATCCGCGTCGGCATCGG
CTACAAGTTCTA
|
|
Protein Sequence |
>gi|23501588|ref|NP_697715.1| outer-membrane protein Omp25 [Brucella suis 1330] MRTLKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF
|
|
Molecule Role |
Virulence factor |
|
Molecule Role Annotation |
SUBCELLULAR LOCATION: Outer membrane(UniProt: Q45689).
SIMILARITY: Belongs to the omp25/ropB family(UniProt: Q45689).
MUTATION: In contrast to WT B suis or Deltaomp31 B suis, Deltaomp25 B suis induced TNF-alpha production when phagocytosed by human macrophages. So Omp25 of B suis is involved in the negative regulation of TNF-alpha production upon infection of human macrophages (Jubier-Maurin et al., 2001).
To determine the role of Omp25 in virulence, mutants were created with Brucella abortus (BA25), Brucella melitensis (BM25), and Brucella ovis (BO25) which contain disruptions in the omp25 gene (Deltaomp25 mutants). BALBc mice infected with B abortus BA25 or B melitensis BM25 showed a significant decrease in mean CFUspleen at 18 and 4 weeks post-infection, respectively, when compared to the virulent parental strain. Mice infected with B ovis BO25 had significantly lower mean CFUspleen counts from 1 to 8 weeks post-infection, at which point the mutant was cleared from the spleens. Murine vaccination with either BM25 or the current caprine vaccine B melitensis strain Rev.1 resulted in more than a 2log (10) reduction in bacterial load following challenge with virulent B melitensis. Vaccination of mice with the B ovis mutant resulted in clearance of the challenge strain and provided 2.5log (10) greater protection against virulent B ovis than vaccine strain Rev.1. Based on these data, the B melitensis and B ovis Deltaomp25 mutants are interesting vaccine candidates that are currently under study in our laboratory for their safety and efficacy in small ruminants (Jubier-Maurin et al., 2001).
Although they are slightly attenuated, B abortus omp25 and omp22 mutants do not show the high level of attenuation and sensitivity to bactericidal peptides displayed by the bvrS and bvrR mutants (Jubier-Maurin et al., 2001). B abortus mutants carrying Omp25 deletions do not show enrichment of underacylated LPS (Jubier-Maurin et al., 2001).
Brucella spp. omp25 deletion mutants are attenuated in mice, cattle and goats, showing the involvement of Brucella spp. Omp25 in virulence (Jubier-Maurin et al., 2001). |
|
COG
|
COG3637M, under M: Cell wall/membrane/envelope biogenesis |
| References |
Jubier-Maurin et al., 2001: Jubier-Maurin V, Boigegrain RA, Cloeckaert A, Gross A, Alvarez-Martinez MT, Terraza A, Liautard J, Köhler S, Rouot B, Dornand J, Liautard JP. Major outer membrane protein Omp25 of Brucella suis is involved in inhibition of tumor necrosis factor alpha production during infection of human macrophages. Infection and immunity. 2001; 69(8); 4823-4830. [PubMed: 11447156].
|
|